PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I01178.3.p
Common NameEUGRSUZ_I01178
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 298aa    MW: 32203.8 Da    PI: 4.8321
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I01178.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.18.2e-28244294151
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                       k r+ W+peLH+rF++a++qLGG+++AtPk+i+elm+v+gLt+++vkSHLQ
  Eucgr.I01178.3.p 244 KRRRSWSPELHQRFLDALQQLGGPQVATPKQIRELMQVDGLTNDEVKSHLQ 294
                       6799*********************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.519241297IPR017930Myb domain
SuperFamilySSF466894.12E-13241294IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-23242294IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23244295IPR006447Myb domain, plants
PfamPF002492.2E-7246294IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MCSASDSSPP PPFVPRTIRH FLTEIADVGD GSSRLDDFVE RLEGELDKID AFKRELPLCM  60
LLLSEAIEAL KNGSMRPSAP SARPVLEQFI PLENDAGGSE GVGEKPKDER RCTTSSPKLV  120
DTAENSSSSS SFDLNENPKA ELQTEIVEEQ KLAACEGQSQ FRTCESRNAD ARQSHPLFPS  180
AMASGELAEI PLHGFLSLGV GIKNPSEESS SSTGTVSGRS RTISSVDCNA PSSSRGGNQQ  240
TAKKRRRSWS PELHQRFLDA LQQLGGPQVA TPKQIRELMQ VDGLTNDEVK SHLQVEV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I01178.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028507.10.0PREDICTED: uncharacterized protein LOC104418763
TrEMBLA0A059AML70.0A0A059AML7_EUCGR; Uncharacterized protein
STRINGVIT_03s0063g01060.t015e-71(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.15e-38G2-like family protein